DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp12

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_038958788.1 Gene:Fabp12 / 499570 RGDID:1565000 Length:151 Species:Rattus norvegicus


Alignment Length:131 Identity:54/131 - (41%)
Similarity:69/131 - (52%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :|....|||:.||||||.|...||:|....|.|.::.:||..|:.|.|.||...||||||.||:|
  Rat     9 WKSVSCENFENYMKELGAGRAIRKLGCLARPVVTISTDGDRITIKTKSIFKNKEISFKLGEEFEE 73

  Fly    73 ETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELITLIPHLTPSQHGSLRLRVPCQPV 136
            .|..||..||.:.||.:.|.|.|..| |..||.|...|.:::  :..|.||.      |:...|.
  Rat    74 ITPGGRKSKSTVVLDNDSLVQVQDWDGKEATIRRRLVDGKMV--VSFLLPSG------RLSRSPF 130

  Fly   137 P 137
            |
  Rat   131 P 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 47/99 (47%)
Fabp12XP_038958788.1 lipocalin_FABP 4..116 CDD:415860 48/108 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350721
Domainoid 1 1.000 113 1.000 Domainoid score I5967
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4699
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm45100
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.