DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and crabp2

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001006863.1 Gene:crabp2 / 448629 XenbaseID:XB-GENE-959098 Length:138 Species:Xenopus tropicalis


Alignment Length:118 Identity:51/118 - (43%)
Similarity:78/118 - (66%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLS--PTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEF 70
            :|:.:|:||:|.:|.|||.::.||:..:.:  |.||:..:|:.:.:.|::|.:|:.||||:|.||
 Frog     8 WKMKQSDNFEEMLKVLGVNMMLRKIAVAAASKPAVEIKQDGEVFYIKTSTTVRTTEISFKIGEEF 72

  Fly    71 DEETLDGRNVKSIIT-LDGNKLTQEQ---KGDKPTTI-VREFT-DNELI-TLI 116
            ||:|:|||..||:.. :..||:..||   |||.|.|. .||.| |.||| |:|
 Frog    73 DEQTVDGRPCKSLAKWVSENKMACEQRLLKGDGPKTAWTRELTNDGELILTMI 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 43/105 (41%)
crabp2NP_001006863.1 CRABP2 3..138 CDD:381236 51/118 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I4999
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48161
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.