DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and fabp4a

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001004682.1 Gene:fabp4a / 447944 ZFINID:ZDB-GENE-040912-132 Length:134 Species:Danio rerio


Alignment Length:113 Identity:50/113 - (44%)
Similarity:71/113 - (62%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTL-EGDTYTLTTTSTFKTSAISFKL 66
            ||| .:|:..|:|||||||.:|||..||::||...|.:.|.: |.....:.:.|||||:.|.|||
Zfish     5 FVG-TWKMTTSDNFDEYMKAIGVGFATRQVGNRTKPNLVVCVDEQGLICMKSQSTFKTTEIKFKL 68

  Fly    67 GVEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            ...|:|.|.|.|...:::|::..||.|:|..| |.:||.||.:|.:||
Zfish    69 NEPFEETTADDRKTTTVMTIENGKLVQKQTWDGKESTIEREVSDGKLI 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 43/101 (43%)
fabp4aNP_001004682.1 FABP11 4..132 CDD:381249 50/113 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592456
Domainoid 1 1.000 120 1.000 Domainoid score I5707
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4730
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm24858
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.