DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and fabp6

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001002076.1 Gene:fabp6 / 415166 ZFINID:ZDB-GENE-040625-49 Length:131 Species:Danio rerio


Alignment Length:95 Identity:26/95 - (27%)
Similarity:47/95 - (49%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAI--- 62
            |:|.| |::.:..|.::.:.|.:|:.......|.......|:...||.:  |.|..:..:.:   
Zfish     1 MAFNG-KWETESQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDF--TWTQYYPNNHVVTN 62

  Fly    63 SFKLGVEFDEETLDGRNVKSIITLDGNKLT 92
            .|.:|.|.|.||:.|:..|.|::::|.|||
Zfish    63 KFIVGKESDMETVGGKKFKGIVSMEGGKLT 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 23/89 (26%)
fabp6NP_001002076.1 Lipocalin 3..131 CDD:304412 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.