DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Rbp1

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_036865.1 Gene:Rbp1 / 25056 RGDID:3543 Length:135 Species:Rattus norvegicus


Alignment Length:94 Identity:35/94 - (37%)
Similarity:58/94 - (61%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :|:..:|||:||::.|.|.:..||:.|.|.|..|:..:||...:.|.|||:...:.|::|.||:|
  Rat     9 WKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEE 73

  Fly    73 ET--LDGRNVKSIITLDGNKLTQEQKGDK 99
            :.  :|.|...:.::.||:||...|||:|
  Rat    74 DLTGIDDRKCMTTVSWDGDKLQCVQKGEK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 35/94 (37%)
Rbp1NP_036865.1 CRBP1 4..134 CDD:381237 35/94 (37%)
Important for interaction with STRA6. /evidence=ECO:0000250|UniProtKB:P09455 22..32 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.