DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp9

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_035728.2 Gene:Fabp9 / 21884 MGIID:1194881 Length:132 Species:Mus musculus


Alignment Length:112 Identity:46/112 - (41%)
Similarity:68/112 - (60%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            |:| .:||..||||:.|::||||....||:...:.|:|.::..|:...:...|..:.:.||||||
Mouse     5 FLG-TWKLISSENFENYVRELGVECEPRKVACLIKPSVSISFNGERMDIQAGSACRNTEISFKLG 68

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQKG-DKPTTIVREFTDNELI 113
            .||:|.|.|.|.|||:||.:|..:.|.||. .|.|||.|:..|.:::
Mouse    69 EEFEETTADNRKVKSLITFEGGSMIQVQKWLGKQTTIKRKIVDGKMV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 43/100 (43%)
Fabp9NP_035728.2 Lipocalin 6..132 CDD:306552 45/111 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847214
Domainoid 1 1.000 111 1.000 Domainoid score I6227
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4825
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm43036
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.