DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and FABP5

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001435.1 Gene:FABP5 / 2171 HGNCID:3560 Length:135 Species:Homo sapiens


Alignment Length:108 Identity:45/108 - (41%)
Similarity:64/108 - (59%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFD 71
            :::|..|:.|||||||||||:..||||....|...:|.:|...|:.|.||.||:..|..||.:|:
Human    10 RWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFE 74

  Fly    72 EETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            |.|.|||..:::.......|.|.|:.| |.:||.|:..|.:|:
Human    75 ETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 43/100 (43%)
FABP5NP_001435.1 FABP5 6..133 CDD:381243 45/108 (42%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:24692551 24..34 6/9 (67%)
Fatty acid binding. /evidence=ECO:0000269|PubMed:10493790, ECO:0000269|PubMed:24531463, ECO:0000269|PubMed:24692551, ECO:0007744|PDB:1B56, ECO:0007744|PDB:4AZM, ECO:0007744|PDB:4LKT 129..131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156800
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4779
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40966
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.