Sequence 1: | NP_001027179.1 | Gene: | fabp / 3772232 | FlyBaseID: | FBgn0037913 | Length: | 157 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001435.1 | Gene: | FABP5 / 2171 | HGNCID: | 3560 | Length: | 135 | Species: | Homo sapiens |
Alignment Length: | 108 | Identity: | 45/108 - (41%) |
---|---|---|---|
Similarity: | 64/108 - (59%) | Gaps: | 1/108 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFD 71
Fly 72 EETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fabp | NP_001027179.1 | Lipocalin | 7..>107 | CDD:278490 | 43/100 (43%) |
FABP5 | NP_001435.1 | FABP5 | 6..133 | CDD:381243 | 45/108 (42%) |
Nuclear localization signal. /evidence=ECO:0000269|PubMed:24692551 | 24..34 | 6/9 (67%) | |||
Fatty acid binding. /evidence=ECO:0000269|PubMed:10493790, ECO:0000269|PubMed:24531463, ECO:0000269|PubMed:24692551, ECO:0007744|PDB:1B56, ECO:0007744|PDB:4AZM, ECO:0007744|PDB:4LKT | 129..131 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156800 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4015 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 119 | 1.000 | Inparanoid score | I4779 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm40966 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11955 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X240 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.850 |