DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and FABP3

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001307925.1 Gene:FABP3 / 2170 HGNCID:3557 Length:144 Species:Homo sapiens


Alignment Length:131 Identity:65/131 - (49%)
Similarity:80/131 - (61%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVGKKYKLDKSENFDEYMKEL-----------GVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTS 55
            :|:| .:||..|:|||:|||.|           |||..||::.:...||..:...||..||.|.|
Human     4 AFLG-TWKLVDSKNFDDYMKSLAHILITFPLPSGVGFATRQVASMTKPTTIIEKNGDILTLKTHS 67

  Fly    56 TFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELITLIPHL 119
            |||.:.|||||||||||.|.|.|.||||:||||.||...||.| :.||:|||..|.:||..:.|.
Human    68 TFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG 132

  Fly   120 T 120
            |
Human   133 T 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 57/111 (51%)
FABP3NP_001307925.1 Lipocalin 6..143 CDD:278490 64/129 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156808
Domainoid 1 1.000 115 1.000 Domainoid score I6016
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4779
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm40966
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2523
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.