DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Rbp1

DIOPT Version :10

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_035384.1 Gene:Rbp1 / 19659 MGIID:97876 Length:135 Species:Mus musculus


Alignment Length:94 Identity:35/94 - (37%)
Similarity:58/94 - (61%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :|:..:|||:||::.|.|.:..||:.|.|.|..|:..:||...:.|.|||:...:.|::|.||:|
Mouse     9 WKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEE 73

  Fly    73 ET--LDGRNVKSIITLDGNKLTQEQKGDK 99
            :.  :|.|...:.::.||:||...|||:|
Mouse    74 DLTGIDDRKCMTTVSWDGDKLQCVQKGEK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 FABP_pancrustacea 2..116 CDD:381252 35/94 (37%)
Rbp1NP_035384.1 CRBP1 4..134 CDD:381237 35/94 (37%)
Important for interaction with STRA6. /evidence=ECO:0000250|UniProtKB:P09455 22..32 2/9 (22%)

Return to query results.
Submit another query.