DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and lbp-5

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_491928.1 Gene:lbp-5 / 191700 WormBaseID:WBGene00002257 Length:136 Species:Caenorhabditis elegans


Alignment Length:129 Identity:55/129 - (42%)
Similarity:79/129 - (61%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            ||| ::||.:||||::|:||:||||:.||...:..||:|:.:.|:.:.:...||||.:.:.|.||
 Worm     6 FVG-RWKLVESENFEDYLKEVGVGLLLRKAACAAKPTLEIKVNGNKWHVNQLSTFKNTTLEFTLG 69

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQK----GDKPTTIVREFTDNELITLIPHLTPSQHGSL 127
            |||||.|.|||..||.||::..|:...||    .|..:.|.|.|...:|||.:      |.||:
 Worm    70 VEFDETTPDGRQFKSTITIEDGKVVHVQKRIKDSDHDSVITRWFEGEKLITTL------QSGSV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 45/103 (44%)
lbp-5NP_491928.1 Lipocalin 7..>115 CDD:278490 48/108 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I4253
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3481
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm14279
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - LDO PTHR11955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2523
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.