DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and lbp-8

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_506444.2 Gene:lbp-8 / 188761 WormBaseID:WBGene00002260 Length:137 Species:Caenorhabditis elegans


Alignment Length:131 Identity:46/131 - (35%)
Similarity:76/131 - (58%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            |:| ::||..||||:||:||:||||:.||..:..|||:|:.|:|||:.....||||.:.::||:.
 Worm     7 FIG-RWKLVHSENFEEYLKEIGVGLLIRKAASLTSPTLEIKLDGDTWHFNQYSTFKNNKLAFKIR 70

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQ---KGDKPTTIVREFTDNELITLIPHLTPSQHGSLRL 129
            .:|.|...|.|:..:::|.:..|....|   |.:..:::...:.:|..:     |...|.||:..
 Worm    71 EKFVEIAPDERSYNTLVTFENGKFISHQDKIKENHHSSVFTTWLENGKL-----LQTYQSGSVIC 130

  Fly   130 R 130
            |
 Worm   131 R 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 38/102 (37%)
lbp-8NP_506444.2 FABP 6..136 CDD:381183 46/131 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164740
Domainoid 1 1.000 103 1.000 Domainoid score I4253
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3481
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm14279
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.