DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Pmp2

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001025476.1 Gene:Pmp2 / 18857 MGIID:102667 Length:132 Species:Mus musculus


Alignment Length:112 Identity:58/112 - (51%)
Similarity:72/112 - (64%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            |:| .:||..||:||:|||.|||||..||:||...|||.::.:||..|:.|.|.||.:.||||||
Mouse     5 FLG-TWKLVSSEHFDDYMKALGVGLANRKLGNLAKPTVIISKKGDYITIRTESAFKNTEISFKLG 68

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .||||.|.|.|..|||:||:...|.|.||.| |.|.|.|...|..::
Mouse    69 QEFDETTADNRKAKSIVTLERGSLKQVQKWDGKETAIRRTLLDGRMV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 55/100 (55%)
Pmp2NP_001025476.1 Lipocalin 6..132 CDD:278490 57/111 (51%)
Fatty acid binding. /evidence=ECO:0000250 127..129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847216
Domainoid 1 1.000 111 1.000 Domainoid score I6227
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4825
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm43036
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.