DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and fabp3

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_694493.1 Gene:fabp3 / 171478 ZFINID:ZDB-GENE-020318-2 Length:133 Species:Danio rerio


Alignment Length:116 Identity:64/116 - (55%)
Similarity:83/116 - (71%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKL 66
            :|:| .:.|.:|:|||||||.:|||..||::.|...||..::.|||.:||.|.||||::.|:|||
Zfish     4 AFIG-TWNLKESKNFDEYMKGIGVGFATRQVANMTKPTTIISKEGDVFTLKTVSTFKSTEINFKL 67

  Fly    67 GVEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNEL-ITL 115
            |.||||.|.|.|.|||:|||||.||...||.| |.||::||.:||.| :||
Zfish    68 GEEFDETTADDRKVKSVITLDGGKLLHVQKWDGKETTLLREVSDNNLTLTL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 56/100 (56%)
fabp3NP_694493.1 Lipocalin 7..120 CDD:278490 63/113 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592458
Domainoid 1 1.000 120 1.000 Domainoid score I5707
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4730
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm24858
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2523
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.