DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp5

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_034764.1 Gene:Fabp5 / 16592 MGIID:101790 Length:135 Species:Mus musculus


Alignment Length:108 Identity:47/108 - (43%)
Similarity:65/108 - (60%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFD 71
            |::|.:|..|:||||||||||..|||.....|...:|.:|:..|:.|.||.||:..|..||.:||
Mouse    10 KWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFD 74

  Fly    72 EETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            |.|.|||..:::.|.....|.|.|:.| |.:||.|:..|.::|
Mouse    75 ETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMI 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 45/100 (45%)
Fabp5NP_034764.1 Lipocalin 9..134 CDD:278490 47/108 (44%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q01469 24..34 7/9 (78%)
Fatty acid binding. /evidence=ECO:0000269|PubMed:24531463, ECO:0007744|PDB:4AZP, ECO:0007744|PDB:4AZQ 129..131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847212
Domainoid 1 1.000 111 1.000 Domainoid score I6227
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4825
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43036
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.