DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp3

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_034304.1 Gene:Fabp3 / 14077 MGIID:95476 Length:133 Species:Mus musculus


Alignment Length:118 Identity:59/118 - (50%)
Similarity:78/118 - (66%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKL 66
            :||| .:||..|:|||:|||.||||..||::.:...||..:...|||.|:.|.||||.:.|:|:|
Mouse     4 AFVG-TWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQL 67

  Fly    67 GVEFDEETLDGRNVKSIITLDGNKLTQEQK-GDKPTTIVREFTDNELITLIPH 118
            |:||||.|.|.|.|||::||||.||...|| ..:.||:.||..|.:||..:.|
Mouse    68 GIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 51/100 (51%)
Fabp3NP_034304.1 Lipocalin 6..132 CDD:278490 58/116 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847220
Domainoid 1 1.000 111 1.000 Domainoid score I6227
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4825
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm43036
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2523
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.