DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and nmnat1-rbp7a

DIOPT Version :10

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001017629.1 Gene:nmnat1-rbp7a / 108004541 -ID:- Length:251 Species:Danio rerio


Alignment Length:100 Identity:37/100 - (37%)
Similarity:52/100 - (52%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKYKLDKSE----NFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKL 66
            |:.|::|..    |     .:.|:||.|||:...|.....:...||.|.:.|.||.|....||::
Zfish   124 KRRKMEKKSPSCMN-----PKAGIGLYTRKIALKLKQRKVIEQLGDRYVVKTLSTVKNYTFSFRV 183

  Fly    67 GVEFDEET--LDGRNVKSIITLDGNKLTQEQKGDK 99
            ..||.|.|  ||.|:.||.::.:||||...|||:|
Zfish   184 NEEFQEFTKGLDDRHCKSAVSWEGNKLVCVQKGEK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 FABP_pancrustacea 2..116 CDD:381252 36/99 (36%)
nmnat1-rbp7aNP_001017629.1 nt_trans 9..>126 CDD:469580 1/1 (100%)
lipocalin_FABP 141..250 CDD:471979 32/77 (42%)

Return to query results.
Submit another query.