DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and pmp2

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001107544.1 Gene:pmp2 / 100135411 XenbaseID:XB-GENE-977969 Length:134 Species:Xenopus tropicalis


Alignment Length:112 Identity:57/112 - (50%)
Similarity:71/112 - (63%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            ||| .:||..|:.|||||:.||||..|||.|....|.|.:::.||...|.|.||.||:.::||||
 Frog     5 FVG-TWKLTDSQGFDEYMQSLGVGFATRKAGAMAKPNVIISVNGDKILLKTESTLKTTDMTFKLG 68

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .||||.|.|.||.|::||.|...|.|.||.| |.|||.||..:.:|:
 Frog    69 EEFDETTADNRNTKTLITCDSGVLNQVQKWDGKETTIQREIKNGQLV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 52/100 (52%)
pmp2NP_001107544.1 FABP3-like 4..131 CDD:381218 57/112 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8227
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.