DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33857 and H3C3

DIOPT Version :9

Sequence 1:NP_001027373.1 Gene:His3:CG33857 / 3772231 FlyBaseID:FBgn0053857 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_003522.1 Gene:H3C3 / 8352 HGNCID:4768 Length:136 Species:Homo sapiens


Alignment Length:136 Identity:135/136 - (99%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||||||
Human    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
Human   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33857NP_001027373.1 PTZ00018 1..136 CDD:185400 133/134 (99%)
H3C3NP_003522.1 PTZ00018 1..136 CDD:185400 133/134 (99%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 41/41 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.