DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33857 and cenpa

DIOPT Version :10

Sequence 1:NP_001027373.1 Gene:His3:CG33857 / 3772231 FlyBaseID:FBgn0053857 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001016585.1 Gene:cenpa / 549339 XenbaseID:XB-GENE-484234 Length:150 Species:Xenopus tropicalis


Alignment Length:189 Identity:46/189 - (24%)
Similarity:67/189 - (35%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VIERLLRISSCKVTTVESGTRALQYLGL----DGGKGASNLKDLKVNLIVTDYSMPGLSGY---- 94
            :||.|...||..|...|...:.|..:|:    ...||..:..|:.       :.|..|..|    
 Frog   241 IIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRSYGDIL-------HRMKDLCRYMNNF 298

  Fly    95 --DLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKP-VKLADVKRI--KQLIMRN 154
              :...|.|....:..:.|...::...:..||..|.:|.......| |.|.||..:  ...|.||
 Frog   299 DSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGDVEIDRN 363

  Fly   155 EAEECKILSH-SNKRKLQEDSDTSSSSHDDTSIKDSSCSKR------MKSESENLFSLL 206
            :        | ..||||.|..:.:..|.||   :|.|...|      .|:|..|...:|
 Frog   364 K--------HIHKKRKLAEGREKTMQSSDD---EDCSAKGRNRHIVVNKAELANSTEVL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33857NP_001027373.1 PTZ00018 1..136 CDD:185400 22/107 (21%)
cenpaNP_001016585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
HFD_H3 49..144 CDD:467036
H3-like 53..150
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.