DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33857 and cid

DIOPT Version :10

Sequence 1:NP_001027373.1 Gene:His3:CG33857 / 3772231 FlyBaseID:FBgn0053857 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:67/148 - (45%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTKQTARKSTGGKAPRKQLATKAA-----------RKSAPATGGVKKPHRYRPGTVALREIRRYQ 56
            |:.||.|.:.     :::..|:||           ||:|......|:..         |||||.|
  Fly    91 RSPQTRRMTV-----QQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD---------REIRRLQ 141

  Fly    57 KSTELLIRKLPFQRLVREIAQDFKTD--LRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 119
            .....||.||||.|||||....:..|  ||....|::|:||:.|.||.....|:.:...|..|||
  Fly   142 HHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVT 206

  Fly   120 IMPKDIQLARRI--RGER 135
            :..:|:.|...|  ||.:
  Fly   207 LEVRDMALMAYICDRGRQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33857NP_001027373.1 PTZ00018 1..136 CDD:185400 48/148 (32%)
cidNP_523730.2 HFD_SF 126..219 CDD:480273 35/101 (35%)

Return to query results.
Submit another query.