DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33840 and h1l1

DIOPT Version :9

Sequence 1:NP_001027344.1 Gene:His1:CG33840 / 3772225 FlyBaseID:FBgn0053840 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_693710.3 Gene:h1l1 / 565341 ZFINID:ZDB-GENE-160113-58 Length:197 Species:Danio rerio


Alignment Length:238 Identity:93/238 - (39%)
Similarity:125/238 - (52%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|.|.:|||..||         :|||:    :|.|||.     |..:.::..::...|||.|
Zfish     1 MAETAPAPAASPAKAP---------KKKAA----SKPKKAG-----PNVRDLIVKTVTASKERNG 47

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.::| .|  |.:|....:|..:|:.|.||.|.||||.||||||||:   ||:.:||.
Zfish    48 VSLAALKKALSAGGY--DVEKNNSRVKTAVKALVTNGTLAQTKGTGASGSFKLN---KKQAEPKK 107

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKK---TAVGAADKKP-KAKKAVATKKTAENKKTEKAKAKD 190
            .:|..:|:.|..:.|.:.||:    ||   |:|..|.|.| ||||..|.||.     |:|||...
Zfish   108 AAKKTAAKAKKPAAKKSPKKV----KKPAATSVKKATKSPKKAKKPAAAKKA-----TKKAKKPA 163

  Fly   191 AKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKK 233
            |.|      |.|.:..||.|.|||....||:|.|   .|.|||
Zfish   164 AAK------KAAKSPKKVKAVKPKTAKPKAAKPK---KAAPKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33840NP_001027344.1 Linker_histone 46..118 CDD:278939 31/72 (43%)
h1l1XP_693710.3 Linker_histone 29..99 CDD:278939 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.