Sequence 1: | NP_001027344.1 | Gene: | His1:CG33840 / 3772225 | FlyBaseID: | FBgn0053840 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506680.1 | Gene: | hil-1 / 179993 | WormBaseID: | WBGene00001852 | Length: | 232 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 57/201 - (28%) |
---|---|---|---|
Similarity: | 93/201 - (46%) | Gaps: | 23/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 HPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKC--DAQKLAPFIKKYLKSAVVNGKLIQTKG 108
Fly 109 KGASGSFKLSASAKK--EKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPK---- 167
Fly 168 -AKKAVATKK-TAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAK 230
Fly 231 PKKTVK 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
His1:CG33840 | NP_001027344.1 | Linker_histone | 46..118 | CDD:278939 | 27/73 (37%) |
hil-1 | NP_506680.1 | Linker_histone | 37..111 | CDD:278939 | 27/73 (37%) |
PKc_like | 96..>140 | CDD:304357 | 13/43 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 65 | 1.000 | Domainoid score | I6615 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000079 | |
OrthoInspector | 1 | 1.000 | - | - | mtm4774 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2142 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |