DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and SFC1

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012629.1 Gene:SFC1 / 853558 SGDID:S000003856 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:94/285 - (32%)
Similarity:144/285 - (50%) Gaps:15/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVAGGITGGIEICITYPTEYVKTQLQLDEKGAA---KKYNGIFDCVKKTVGERGFLGLYRGLSVL 98
            ::|||..|..|....:|.:.:|.::|:..:.|.   .|..|.....:....:.|||.||:||..:
Yeast    14 LMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAV 78

  Fly    99 VYGSIPKSAARFGAFEFLKSNAVDSR-GQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVK----- 157
            |.|.|||.|.||.::||.::..|:.. |.:|.....:.|:|||:.||::.|.|||.:|::     
Yeast    79 VIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQH 143

  Fly   158 FINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDH 222
            ....:.:..||:....|....|:|.||:|.:|:|::.|..:|.:||...|.|...||:..:....
Yeast   144 LTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQ 208

  Fly   223 TKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQ-----GLE-ASKYKNTAHCAVEILKNEGPA 281
            ...:|.......|.|:||...|.|.|||.:|||:|     .|| .|..|.......::||.||..
Yeast   209 MDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFR 273

  Fly   282 AFYKGTVPRLGRVCLDVAITFMIYD 306
            |.|||..||:.||....|:||.:|:
Yeast   274 ALYKGITPRVMRVAPGQAVTFTVYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 91/279 (33%)
Mito_carr 34..117 CDD:278578 28/82 (34%)
Mito_carr 125..220 CDD:278578 31/99 (31%)
Mito_carr 235..314 CDD:278578 33/78 (42%)
SFC1NP_012629.1 Mito_carr 6..103 CDD:395101 29/88 (33%)
Mito_carr 108..206 CDD:395101 30/97 (31%)
Mito_carr 210..304 CDD:395101 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.