DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and MRX20

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_116703.5 Gene:MRX20 / 850606 SGDID:S000001941 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:86/310 - (27%)
Similarity:136/310 - (43%) Gaps:60/310 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLV 99
            |.|.||.:....:..:|||.||:||.|||..||.|      |:.:...: :..|:|. ..|:|..
Yeast    10 KQITAGSVAAVFQTTMTYPFEYLKTGLQLQPKGTA------FEIILPQI-KSYFVGC-SALNVAA 66

  Fly   100 YGSIPKSAARFGAFEFL---KSNAVDSRG---QLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKF 158
            :|   |:..||..|:.|   .:|.:|:..   :|:....|:.|...|:.|::. :.|.|.||...
Yeast    67 FG---KTILRFVTFDKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLF-IIPFENIKTTL 127

  Fly   159 INDQRSGNPKF---------RGFAH-----------------GVGQIIKSEGISGIYKGLTPTIL 197
            |......:.|.         :...|                 .|..:.::.|.:...:|.|.||.
Yeast   128 IQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIF 192

  Fly   198 KQGSNQAIRFFVLESLKDLYKG-DDHTKPVPKLVVGVFGAIAGAASVFG----NTPLDVVKTRMQ 257
            :|.:|.:|:|....:.|.|.:. :|....|          |.|.|:.|.    ..|:|||||||.
Yeast   193 RQIANTSIQFTAYTAFKRLLQARNDKASSV----------ITGLATSFTLVAMTQPIDVVKTRMM 247

  Fly   258 GLEA-SKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306
            ...| ::||||.:|...|...||.|.|:||::.|..:|.:...:||.:|:
Yeast   248 SQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 83/304 (27%)
Mito_carr 34..117 CDD:278578 28/84 (33%)
Mito_carr 125..220 CDD:278578 24/124 (19%)
Mito_carr 235..314 CDD:278578 30/77 (39%)
MRX20NP_116703.5 Mito_carr 8..80 CDD:395101 27/80 (34%)
Mito_carr 95..213 CDD:395101 24/118 (20%)
Mito_carr 219..307 CDD:395101 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45788
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.