DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and si:dkey-178e17.1

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_021334024.1 Gene:si:dkey-178e17.1 / 793282 ZFINID:ZDB-GENE-081104-41 Length:274 Species:Danio rerio


Alignment Length:240 Identity:161/240 - (67%)
Similarity:194/240 - (80%) Gaps:0/240 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGV 141
            |||.:||...|..|||||||.|:||||||||||||.||.|.:...|..|:|.::..|||||||||
Zfish    32 DCVSQTVRHHGVKGLYRGLSSLLYGSIPKSAARFGVFEILSNQMKDESGKLDSTRGLLCGLGAGV 96

  Fly   142 CEAIVAVTPMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIR 206
            .||::.|.||||:|||||:||.|.|||:|||.|||.:||:::||.|.|:|||.|:||||||||||
Zfish    97 MEAVLVVCPMETVKVKFIHDQTSANPKYRGFFHGVREIIRTQGIRGTYQGLTATVLKQGSNQAIR 161

  Fly   207 FFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCA 271
            |||:.||::.||||:..|.:..:|.|.||||||||||||||||||:|||||||||.|||||..||
Zfish   162 FFVMTSLRNWYKGDNPNKSINPVVTGTFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYKNTMDCA 226

  Fly   272 VEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKVW 316
            ::|:::|||||||||||||||||||||||.|:||:..:.:.||.|
Zfish   227 MKIMRHEGPAAFYKGTVPRLGRVCLDVAIVFIIYEEVVKILNKAW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 155/224 (69%)
Mito_carr 34..117 CDD:278578 28/39 (72%)
Mito_carr 125..220 CDD:278578 62/94 (66%)
Mito_carr 235..314 CDD:278578 60/78 (77%)
si:dkey-178e17.1XP_021334024.1 Mito_carr <32..79 CDD:332982 30/46 (65%)
Mito_carr 80..176 CDD:278578 63/95 (66%)
Mito_carr 179..269 CDD:278578 64/89 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4920
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 401 1.000 Inparanoid score I1885
OMA 1 1.010 - - QHG58666
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 1 1.000 - - otm25840
orthoMCL 1 0.900 - - OOG6_104005
Panther 1 1.100 - - O PTHR45788
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.