DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG1907

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:312 Identity:79/312 - (25%)
Similarity:142/312 - (45%) Gaps:30/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AADSGQVGLKGIVA--------GGITGGIEICITYPTEYVKTQLQLDEKGAAKK-YNGIFDCVKK 81
            :|.|.|...|..||        ||::|.....:..|.:.|||::|:...|:.|| |.....|::.
  Fly     2 SATSVQEAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQT 66

  Fly    82 TVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSN--SGKLLCGLGAGVCEA 144
            .|.:.|.|.||:|:...:......:..|.|.:.:| ::....:.|.|.  :..:..|..||.|.|
  Fly    67 IVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYL-NDLFREKFQRSPGITDSMAMGTIAGACGA 130

  Fly   145 IVAVTPMETIKVKFINDQR---SGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIR 206
            .:. ||.|...|:..:|.|   :....:...|:.:.:|.:.||::.:::|..||:   |....:.
  Fly   131 FIG-TPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTV---GRAMVVN 191

  Fly   207 FFVLESLKDLYKGDDHTKPVPKLVVGV---FGA--IAGAASVFGNTPLDVVKTRMQGLE----AS 262
            ...|.|... :|......|: ::..|:   |.|  ::|..:...:.|||:.|||:|.::    ..
  Fly   192 MTQLASYSQ-FKTYFRHGPL-QMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP 254

  Fly   263 KYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNK 314
            :|:.||...:.:.:.||..|.:||..|...|:.....:||:|.:.....:||
  Fly   255 EYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 71/290 (24%)
Mito_carr 34..117 CDD:278578 24/91 (26%)
Mito_carr 125..220 CDD:278578 24/99 (24%)
Mito_carr 235..314 CDD:278578 22/84 (26%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 22/93 (24%)
Mito_carr 118..207 CDD:278578 22/93 (24%)
Mito_carr 219..307 CDD:278578 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.