DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG4743

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:320 Identity:95/320 - (29%)
Similarity:135/320 - (42%) Gaps:73/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EHGAAAADSGQVGLK------------GIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYN 73
            |.|..:| :|.|.:|            .:||||:.|.:.....:|.:.|||:|| .|.|..:   
  Fly     4 ELGLESA-AGSVAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQ-SELGFWR--- 63

  Fly    74 GIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFE----FLKSNAVDSRGQLSNSG--K 132
                       ..||.|:|:||:....||.|.:|..|..:|    ||.|..     |..:|.  .
  Fly    64 -----------AGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVT-----QTKDSPYVH 112

  Fly   133 LLCGLGAGVCEAIVAVTPMETIKVKFINDQRS----GNPKFRGFAHGVGQII----KSEGIS-GI 188
            :.....|.|...::.| |:|..|      |||    || |..|.     ||:    ::||:. |:
  Fly   113 MAAASAAEVLACLIRV-PVEIAK------QRSQTLQGN-KQSGL-----QILLRAYRTEGLKRGL 164

  Fly   189 YKGLTPTILKQGSNQAIRFFVLESLKDLY---KGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLD 250
            |:|...||:::.....|:|.:.|..|..:   .|.|.|    ...|.:.||:||..|....||||
  Fly   165 YRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDST----PFSVALCGAVAGGISAGLTTPLD 225

  Fly   251 VVKTRMQGLEASKYKNTAHCAVEILK----NEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306
            |||||:. |...:..|....|..||.    ..|.:..:.|.|||:..:.|..|..|..||
  Fly   226 VVKTRIM-LAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 87/301 (29%)
Mito_carr 34..117 CDD:278578 27/98 (28%)
Mito_carr 125..220 CDD:278578 28/108 (26%)
Mito_carr 235..314 CDD:278578 29/76 (38%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/90 (28%)
PTZ00168 25..281 CDD:185494 86/293 (29%)
Mito_carr 199..291 CDD:278578 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.