DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG5805

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:284 Identity:66/284 - (23%)
Similarity:117/284 - (41%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAF 113
            |..:|...:|||||:..|  :..|.|:.||..|.....|..|||||..:        |:.:..:.
  Fly    55 CCLFPLTVIKTQLQVQHK--SDVYKGMVDCAMKIYRSEGVPGLYRGFWI--------SSVQIVSG 109

  Fly   114 EFLKSNAVDSRGQLSN--SGKLLCGLGAGVCEAIVA---VTPMETIKVKFINDQRSGNPKFRGFA 173
            .|..|.....|..|::  :|..:..|..|.|.::|.   :.|.:.|....:....|.:...:|..
  Fly   110 VFYISTYEGVRHVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDI 174

  Fly   174 HGVG------------------QIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGD 220
            :.:|                  :|::.:|..|.|:|.|.:::....|.|:.:    :...||: |
  Fly   175 NPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWW----AFYHLYQ-D 234

  Fly   221 DHTKPVPKLVVGVF-----GAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGP 280
            :..:..|..|..:|     |::.|..:.....|||:|:.|:|   ..:..:.:....|:.:.|..
  Fly   235 ELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQ---VHRLDSMSVAFRELWQEEKL 296

  Fly   281 AAFYKGTVPRLGRVCLDVAITFMI 304
            ..|:||...||.:   ..|.:|.|
  Fly   297 NCFFKGLSARLVQ---SAAFSFSI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 64/280 (23%)
Mito_carr 34..117 CDD:278578 21/67 (31%)
Mito_carr 125..220 CDD:278578 21/117 (18%)
Mito_carr 235..314 CDD:278578 18/70 (26%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 24/79 (30%)
Mito_carr 132..238 CDD:395101 20/110 (18%)
Mito_carr 245..327 CDD:395101 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.