DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and DPCoAC

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:325 Identity:82/325 - (25%)
Similarity:138/325 - (42%) Gaps:43/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASLVSPYRRRPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQLQLDEK----- 66
            |:.|:|.|::            ..||.: .:::|...|.:...:..|.:..|...|:...     
  Fly    59 ATTVTPMRQK------------IDQVVI-SLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSF 110

  Fly    67 GAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFE-FLKSNAVDSRGQLSNS 130
            .|:.:|      ::.|....|.|.|:||.|..:...:|.:|.:|.|.| :.:...||..|..:..
  Fly   111 RASLRY------LQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKG 169

  Fly   131 GKLLCGLGAGVCEAIVAVTPMETIKVKF-INDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTP 194
            .:.|.|..||:....:.. |::..:.:. :.|:.:|   :|.......:|...||...:::|...
  Fly   170 RRFLAGSLAGITSQSLTY-PLDLARARMAVTDRYTG---YRTLRQVFTKIWVEEGPRTLFRGYWA 230

  Fly   195 TILKQGSNQAIRFFVLESLK-DLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQG 258
            |:|.........||..|:|| :.|:...:.|| ..||...|||.||||....:.|||:|:.|||.
  Fly   231 TVLGVIPYAGTSFFTYETLKREYYEVVGNNKP-NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQT 294

  Fly   259 LEAS-----KYKNTAHCAVEILKNEG-PAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKVWV 317
            :..:     :|.......|:|.:.|| ...||||......:..:.|.|:|..||..     |.|:
  Fly   295 MRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLI-----KAWL 354

  Fly   318  317
              Fly   355  354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 71/281 (25%)
Mito_carr 34..117 CDD:278578 19/88 (22%)
Mito_carr 125..220 CDD:278578 21/96 (22%)
Mito_carr 235..314 CDD:278578 27/84 (32%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 20/93 (22%)
Mito_carr 169..251 CDD:278578 18/85 (21%)
Mito_carr 279..356 CDD:278578 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442074
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.