DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and GC2

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:293 Identity:89/293 - (30%)
Similarity:144/293 - (49%) Gaps:20/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVAGGITGGIEICITYPTEYVKTQLQLDEKG--AAKKYNGIFDCVKKTVGERGFLGLYRGLSVLV 99
            |:.||:.|.|.:...||.:.|||:||....|  ..:.|..|.||.:||:...|:.|:|||.:|.:
  Fly    24 IINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNI 88

  Fly   100 YGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFIN---- 160
            ....|:.|.:..|.:|.:.:.....|.:..|...|.|..||:.: ||..||||.:|::..:    
  Fly    89 VLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQ-IVVTTPMELLKIQMQDAGRV 152

  Fly   161 ---DQRSGNPKFRGFAHGVGQ-IIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDL--YKG 219
               |:.:|.......|.|:.: :::..||.|:|||:..|.::..:...:.|.::..:.|.  .|.
  Fly   153 AAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWINDQGPRKS 217

  Fly   220 DDHTKPV--PKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAA 282
            |...:.|  ..|:.|:   ::|..|.|..||.||||||:|.....|:|....|....||.||.:|
  Fly   218 DGSGEAVFYWSLIAGL---LSGMTSAFMVTPFDVVKTRLQADGEKKFKGIMDCVNRTLKEEGISA 279

  Fly   283 FYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKV 315
            |:||.:.|:..:.....|..|.|  |:.:..|:
  Fly   280 FFKGGLCRIMVLAPLFGIAQMFY--FLGVGEKI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 85/278 (31%)
Mito_carr 34..117 CDD:278578 29/81 (36%)
Mito_carr 125..220 CDD:278578 27/104 (26%)
Mito_carr 235..314 CDD:278578 28/78 (36%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 84/268 (31%)
Mito_carr 16..106 CDD:278578 29/81 (36%)
Mito_carr 123..203 CDD:278578 22/80 (28%)
Mito_carr 228..302 CDD:278578 28/76 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.