DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and GC1

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:280 Identity:86/280 - (30%)
Similarity:139/280 - (49%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LKGIVAGGITGGIEICITYPTEYVKTQLQLDEKG--AAKKYNGIFDCVKKTVGERGFLGLYRGLS 96
            |..|:.|||.|.|.:...:|.:.|||:||..:.|  ..:.||.:|||.:||....|:.|:|||..
  Fly    22 LPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSG 86

  Fly    97 VLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFIND 161
            |.:....|:.|.:..|.::.:.......|:|..:.:::.|..||..: |:..||||.:|::..:.
  Fly    87 VNILLITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQ-IIVTTPMELLKIQMQDA 150

  Fly   162 QR-SGNPKFRG-------FAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDL-- 216
            .| :...|..|       ......|:||.:||.|:|||:..|.|:..:...|.|.:..:|.||  
  Fly   151 GRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGP 215

  Fly   217 YKGDDHTKPVPKLVVGVF------GAIAGAASVFGNTPLDVVKTRMQGLEAS----KYKNTAHCA 271
            .:.|...:       .||      |..||:.:.....|.||||||:|.::.:    ::|..:.|.
  Fly   216 RRNDGSGE-------AVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCI 273

  Fly   272 VEILKNEGPAAFYKGTVPRL 291
            .:.||:|||.||:||.:.|:
  Fly   274 TKTLKHEGPTAFFKGGLCRM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 86/280 (31%)
Mito_carr 34..117 CDD:278578 30/84 (36%)
Mito_carr 125..220 CDD:278578 30/104 (29%)
Mito_carr 235..314 CDD:278578 23/61 (38%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 23/76 (30%)
Mito_carr 115..213 CDD:278578 28/98 (29%)
Mito_carr 226..307 CDD:278578 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.