DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and SLC25A53

DIOPT Version :10

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001012773.2 Gene:SLC25A53 / 401612 HGNCID:31894 Length:307 Species:Homo sapiens


Alignment Length:214 Identity:44/214 - (20%)
Similarity:79/214 - (36%) Gaps:57/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 CLAYLMLIEYKLAVFAET--------------TG--LEISNNRSFYEYLKNLYKHLLAKFRLYST 668
            ||..|.|...:|..|..|              :|  :::|.|.|    |.||:..|:.   |...
Human    33 CLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKIDVSLNIS----LPNLHCELVG---LDIQ 90

  Fly   669 DVFG---VSCLKNTEEMILNDD-----HDKFDLNTQCFKFCQETNAYFFCICIRGKFIQLRSEEL 725
            |..|   |..:.|:.::.||:.     ..:|.:|.....|...|::         ...|.::.::
Human    91 DEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHS---------ATAQPQNPDM 146

  Fly   726 MHNVSKL---DREEIEQQHEIF---FGLDKTNKNNHLSSFWRTECMPIVLDQENLEPIYK----- 779
            .|.:.||   |..:::..|..|   .|.|:...|...|..:..:.:|.|.:.::.:..|.     
Human   147 THTIHKLSFGDTLQVQNVHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTV 211

  Fly   780 ATTDFVCGKYN------IW 792
            |..::|...:.      ||
Human   212 ANKEYVAYSHTGRIIPAIW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 Mito_carr 34..117 CDD:395101
Mito_carr 125..220 CDD:395101
Mito_carr 235..314 CDD:395101
SLC25A53NP_001012773.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Solcar 1 25..105 20/78 (26%)
Mito_carr 31..102 CDD:395101 19/75 (25%)
Mito_carr 110..203 CDD:395101 18/101 (18%)
Solcar 2 112..202 17/98 (17%)
Solcar 3 210..302 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.