DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Dic4

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:273 Identity:64/273 - (23%)
Similarity:119/273 - (43%) Gaps:24/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GGIEICITY---PTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPK 105
            |...:|:.:   |.:.|||.:|:.     ::...|...||:....:|:||.|.|.|..:...:..
  Fly    27 GFASMCVAFAVAPIDIVKTHMQIQ-----RQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTS 86

  Fly   106 SAARFGAFEF-LKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRSGNPKF 169
            :...|..::. .|...||....|   ||::.|..||.|.:...: |.:.|.|:...|.:....|.
  Fly    87 TNIHFIVYDTGKKMEYVDRDSYL---GKIILGCVAGACGSAFGI-PTDLINVRMQTDMKEPPYKR 147

  Fly   170 RGFAH---GVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLK-DLYKGDDHTKPVPKLV 230
            |.:.|   |:.:|.|.||...:|||.:..:.|...:...:....:.:| ::.|.......:|...
  Fly   148 RNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLPLHF 212

  Fly   231 VGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILK--NEGPAAFYKGTVPRLGR 293
            :...|....::::  ..|||||:|.|......:::.....:|.:::  ..||   |:|.||.:.|
  Fly   213 LTSLGTSIISSAI--THPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGP---YRGFVPTIVR 272

  Fly   294 VCLDVAITFMIYD 306
            ......:.|::|:
  Fly   273 KAPATTLLFVLYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 62/267 (23%)
Mito_carr 34..117 CDD:278578 17/76 (22%)
Mito_carr 125..220 CDD:278578 25/98 (26%)
Mito_carr 235..314 CDD:278578 18/74 (24%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 64/273 (23%)
Mito_carr 26..100 CDD:278578 17/77 (22%)
Mito_carr 104..201 CDD:278578 25/100 (25%)
Mito_carr 211..292 CDD:278578 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.