DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG6893

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:279 Identity:63/279 - (22%)
Similarity:118/279 - (42%) Gaps:33/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSI 103
            :||:.|.|..|.|.|.:.::.::.:     .||..|:...:::.:...||:.||.|||..:...:
  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVV-----IKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQL 79

  Fly   104 PKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKF-INDQRSGNP 167
            ..::.||..:|..|.:..|..|.|.   |:|....|| |.|.|..||||.|..:. :|   ...|
  Fly    80 TYTSMRFHLYEMGKEHLDDPAGLLD---KVLVAALAG-CVAGVVGTPMELINTRMQVN---RALP 137

  Fly   168 K-----FRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHTKPVP 227
            |     :|....|:.::.:.||.:.:|.|...:.::.......:....:..|.:|....|.|...
  Fly   138 KETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDN 202

  Fly   228 KLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHC-----AVEILKNEGPAAFYKGT 287
            .|:    ..|:...:.|...|:      ::.:|..:|......     ::..:...|....::|.
  Fly   203 TLL----HLISSVTAAFVCGPI------IKPIENLRYLRMVDSRRLINSISYMMRFGSRGPFRGM 257

  Fly   288 VPRLGRVCLDVAITFMIYD 306
            ||.:.|:..:..|||:.::
  Fly   258 VPYVLRMVPNTVITFLSFE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 61/273 (22%)
Mito_carr 34..117 CDD:278578 20/77 (26%)
Mito_carr 125..220 CDD:278578 25/100 (25%)
Mito_carr 235..314 CDD:278578 13/77 (17%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/80 (26%)
Mito_carr 98..192 CDD:395101 25/100 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.