DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Mpcp2

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:332 Identity:91/332 - (27%)
Similarity:139/332 - (41%) Gaps:55/332 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AFASLVSPYRRRPWMTEHGAAAA-------DSGQVG-LKGIVAGGITGGIEICIT-----YPTEY 56
            |.|.:|.|   :|......||||       ||.:.| .|.....|| |||..|.|     .|.:.
  Fly    25 AAAPVVEP---QPVEGRQIAAAATPVANQQDSCEFGSTKYFALCGI-GGILSCGTTHTFVVPLDL 85

  Fly    57 VKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAV 121
            ||.:||:|:    .||..:....|.||.|.|..||.:|....:.|...:...:||.:|..|....
  Fly    86 VKCRLQVDQ----AKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYA 146

  Fly   122 DSRGQ----LSNSGKLLCGLGAGVCEAIVAVTPMETIKVK------FINDQRSGNPKFRGFAHGV 176
            :..|:    |..:...|....:....|.:|:.|.|..|||      :.|:.|...||        
  Fly   147 EIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPK-------- 203

  Fly   177 GQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLE-SLKDLYK------GDDHTKPVPKLVVGVF 234
              ::|.||::..||||.|..::|.....::|...| :::.|||      ..|.||....:|....
  Fly   204 --MLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAA 266

  Fly   235 GAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVA 299
            |.|||......:.|.|||.:::...:.:.       |:.:.|:.|.:..:.|..||:..:....|
  Fly   267 GYIAGVFCAVVSHPADVVVSKLNQAKGAS-------AISVAKSLGFSGMWNGLTPRIIMIGTLTA 324

  Fly   300 ITFMIYD 306
            :.:.|||
  Fly   325 LQWFIYD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 76/289 (26%)
Mito_carr 34..117 CDD:278578 28/87 (32%)
Mito_carr 125..220 CDD:278578 28/111 (25%)
Mito_carr 235..314 CDD:278578 18/72 (25%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 28/88 (32%)
Mito_carr <175..245 CDD:278578 23/79 (29%)
Mito_carr 260..338 CDD:278578 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.