DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and slc25a1

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_989391.1 Gene:slc25a1 / 395026 XenbaseID:XB-GENE-491686 Length:332 Species:Xenopus tropicalis


Alignment Length:297 Identity:203/297 - (68%)
Similarity:235/297 - (79%) Gaps:4/297 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AAAADSGQVGL----KGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVG 84
            ||||.:|...|    |.|:||||.||||||||:||||||||||||||....:|.||:|||::||.
 Frog    33 AAAAPAGGSKLTHPGKAILAGGIAGGIEICITFPTEYVKTQLQLDEKANPPRYRGIWDCVRQTVE 97

  Fly    85 ERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVT 149
            ..|..|||||||.|:||||||:|.|||.||||.:...|:.|:|.:...|||||||||.||:|.|.
 Frog    98 GHGVKGLYRGLSSLLYGSIPKAAVRFGMFEFLSNRMRDANGKLDSKRSLLCGLGAGVAEAVVVVC 162

  Fly   150 PMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLK 214
            ||||||||||:||.|.|||:|||.|||.:||:.:||.|.|:|||.|:|||||||||||||:.||:
 Frog   163 PMETIKVKFIHDQCSPNPKYRGFFHGVREIIRVQGIKGTYQGLTATVLKQGSNQAIRFFVMTSLR 227

  Fly   215 DLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEG 279
            :.|:|||..||:..||.|.||||||||||||||||||||||||||||.|||:|..||.:|||.||
 Frog   228 NWYRGDDPNKPMNPLVTGAFGAIAGAASVFGNTPLDVVKTRMQGLEAHKYKSTWDCAYKILKYEG 292

  Fly   280 PAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKVW 316
            |.||||||:||||||||||||.|:|||..:.:.||||
 Frog   293 PRAFYKGTIPRLGRVCLDVAIVFIIYDEVVKVLNKVW 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 190/271 (70%)
Mito_carr 34..117 CDD:278578 59/86 (69%)
Mito_carr 125..220 CDD:278578 63/94 (67%)
Mito_carr 235..314 CDD:278578 61/78 (78%)
slc25a1NP_989391.1 Mito_carr 45..135 CDD:365909 59/89 (66%)
Mito_carr <162..232 CDD:365909 48/69 (70%)
Mito_carr 255..327 CDD:365909 54/71 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5090
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4362
Inparanoid 1 1.050 401 1.000 Inparanoid score I1874
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 1 1.000 - - oto104005
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1828
SonicParanoid 1 1.000 - - X3276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.080

Return to query results.
Submit another query.