DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Bmcp

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:336 Identity:92/336 - (27%)
Similarity:144/336 - (42%) Gaps:90/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQLQ-----LDEKGAAKKYNGI 75
            ||::  :|..|:.:.:.|                 |:|.:..||:||     :|:..:..:|.|:
  Fly     8 RPFV--YGGVASITAEFG-----------------TFPIDTTKTRLQIQGQKIDQSFSQLRYRGM 53

  Fly    76 FDCVKKTVGERGFLGLYRGL--SVL---VYGSIPKSAARFGAFEFLKSNAVDSRGQLSNS----- 130
            .|...|...|.|...||.|:  :||   .||:|     :||.:..||..| :.||.|.|.     
  Fly    54 TDAFVKISREEGLRALYSGIWPAVLRQATYGTI-----KFGTYYTLKKLA-NERGLLINEDGSER 112

  Fly   131 --GKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLT 193
              ..:||...||...:.:| .|.:.:||:.   |..|..:.:|.....|:|.|.||:.|:::|:.
  Fly   113 VWSNILCAAAAGAISSAIA-NPTDVLKVRM---QVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVG 173

  Fly   194 PTILKQGSNQAIRFFVLESLK----DLYK------GDDHTKPVPKLVVG---VFGAIAGAASVFG 245
            ||        |.|..|:.|::    |..|      ..||        ||   :...||...|...
  Fly   174 PT--------AQRAVVIASVELPVYDFCKLQLMNAFGDH--------VGNHFISSFIASLGSAIA 222

  Fly   246 NTPLDVVKTR----------MQGLEASK-----YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVC 295
            :||:||::||          |.|:..:.     |..:..|||:.::|||..|.|||.:|...|:.
  Fly   223 STPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMG 287

  Fly   296 LDVAITFMIYD 306
            ....|.|:.|:
  Fly   288 PWNIIFFITYE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 85/312 (27%)
Mito_carr 34..117 CDD:278578 23/92 (25%)
Mito_carr 125..220 CDD:278578 29/111 (26%)
Mito_carr 235..314 CDD:278578 27/87 (31%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/112 (27%)
Mito_carr <132..199 CDD:278578 21/77 (27%)
Mito_carr 204..303 CDD:278578 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.