DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Shawn

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:343 Identity:87/343 - (25%)
Similarity:135/343 - (39%) Gaps:81/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VAGGITGG-IEICITYPTEYVKTQLQLDEK----------------------------GAAK--- 70
            ||...||. :..|...|.:.:||:||..::                            .|||   
  Fly    43 VASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAP 107

  Fly    71 KYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSR----------- 124
            :::|..|...|.....|...|:.|||..:..::|.:...|.|:|..|:...|..           
  Fly   108 RFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIA 172

  Fly   125 GQLSNSGKLLCGLGAGVCEAIVAVT---PMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSEGIS 186
            ..:.:....|..|.|||...|:|||   |:|.|:.| :..||..:.:..|   .:.|:::|:|:.
  Fly   173 HDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTK-MQSQRMTHAEMFG---TIRQVVQSQGVL 233

  Fly   187 GIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHTKPVPKLVVGVF------GAIAGAASVFG 245
            |:::||.||||:......|.:...|.||..:          .:|...|      |||:|:.:...
  Fly   234 GLWRGLPPTILRDVPFSGIYWTCYEYLKSSF----------GVVEPTFSFSFAAGAISGSVAATI 288

  Fly   246 NTPLDVVKTRMQGLEASKY------------KNTAHCAVEILKNEGPAAFYKGTVPRLGRV---C 295
            .||.|||||..|.....|:            |:.|.....|.:..|..|.:.|..|||.:|   |
  Fly   289 TTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPAC 353

  Fly   296 LDVAITFMIYDSFMDLFN 313
            ..:..:|....||...:|
  Fly   354 AIMISSFEYGKSFFYHYN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 83/330 (25%)
Mito_carr 34..117 CDD:278578 25/110 (23%)
Mito_carr 125..220 CDD:278578 30/97 (31%)
Mito_carr 235..314 CDD:278578 28/94 (30%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 26/115 (23%)
Mito_carr 178..265 CDD:278578 30/100 (30%)
Mito_carr 268..371 CDD:278578 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.