DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Mpcp1

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:329 Identity:87/329 - (26%)
Similarity:136/329 - (41%) Gaps:59/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VSPYRRRPWMTEHGAAAA-----DSGQ---------VGLKGIVAGGITGGIEICITYPTEYVKTQ 60
            |:|   |.....|..|||     ||.:         .||.||::.|.|..:.:    |.:.||.:
  Fly    45 VAP---RQLTRNHNIAAAAVAEGDSCEFGSNHYFLLCGLGGIISCGSTHTMVV----PLDLVKCR 102

  Fly    61 LQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRG 125
            ||:|    ..||..:|...:.::.|.|..||.:|.:....|...:...:||.:|..|....|:.|
  Fly   103 LQVD----PAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIG 163

  Fly   126 Q----LSNSGKLLCGLGAGVCEAIVAVTPMETIKVK------FINDQRSGNPKFRGFAHGVGQII 180
            :    |..:|..|....:....|.:|:.|||..|||      |....|...||          :.
  Fly   164 EENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPK----------MT 218

  Fly   181 KSEGISGIYKGLTPTILKQGSNQAIRFFVLE-SLKDLYK------GDDHTKPVPKLVVGVFGAIA 238
            ..||::..||||.|..::|.....::|...| :|:.|||      ..|.||....:|....|.||
  Fly   219 AQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIA 283

  Fly   239 GAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFM 303
            |......:.|.|.|.:::...:.:.       |:::.|..|.:..:.|.|||:..:....|..:.
  Fly   284 GVFCAIVSHPADTVVSKLNQAKGAS-------ALDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWF 341

  Fly   304 IYDS 307
            |||:
  Fly   342 IYDA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 74/284 (26%)
Mito_carr 34..117 CDD:278578 23/82 (28%)
Mito_carr 125..220 CDD:278578 30/111 (27%)
Mito_carr 235..314 CDD:278578 18/73 (25%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 25/96 (26%)
Mito_carr <188..258 CDD:278578 24/79 (30%)
Mito_carr 273..350 CDD:278578 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.