DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG18327

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:308 Identity:76/308 - (24%)
Similarity:130/308 - (42%) Gaps:43/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAK-----KYNGIFDCVKKTVGERGFLGLYR 93
            |.|:.|.|  .|:   .|.|.|.:||::||..:.||:     .|..:|..........|.|||.:
  Fly     8 LGGVAAMG--AGV---FTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQK 67

  Fly    94 GLSVLVYGSIPKSAARFGAFEF---LKSNAVD------SRGQLSNSGKLLCGLGAGVCEAIVAVT 149
            ||:       |....:|....|   :.::||:      ::|::|.:..:..|...||..:..| :
  Fly    68 GLA-------PALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCA-S 124

  Fly   150 PMETIKVKFINDQRSGNPKFRGFAH-------GVGQIIKSEGISGIYKGLTPTILKQGSNQAIRF 207
            |...||.:.  ..::......|:.|       .:.:|.:..|:.|:::|....:.:.....|::.
  Fly   125 PFFLIKTQL--QAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQI 187

  Fly   208 FVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRM--QGLEAS----KYKN 266
            .|....|.|.| ::.....|.::....|..||:......||||||.||:  ||::|.    .|:.
  Fly   188 AVFGQAKSLLK-ENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRG 251

  Fly   267 TAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNK 314
            ...|.:.||::||....|||..|...|......:..:.:|..:.|..|
  Fly   252 WLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 73/294 (25%)
Mito_carr 34..117 CDD:278578 25/90 (28%)
Mito_carr 125..220 CDD:278578 20/101 (20%)
Mito_carr 235..314 CDD:278578 27/84 (32%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 25/90 (28%)
PTZ00169 5..293 CDD:240302 74/300 (25%)
Mito_carr 101..201 CDD:278578 20/103 (19%)
Mito_carr 204..296 CDD:278578 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.