DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG8323

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:306 Identity:77/306 - (25%)
Similarity:128/306 - (41%) Gaps:42/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VAGGITGGIEICITYPTEYVKTQLQLDEKGAAK-----KYNGIFDCVKKTVGERGFLGLYRGLSV 97
            |.||:........|.|.|.:||::||..:.||:     .|.||.:.........|..||.:||:.
  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAP 71

  Fly    98 LVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGA--GVCEAIVAV---TPMETIKVK 157
            .:|.....::.|...:    |.|::.|...:..|::..|:|.  |....:|..   :|...||.:
  Fly    72 ALYFQFIINSFRLSIY----SEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQ 132

  Fly   158 FINDQRSGNPKFRGFAH-------GVGQIIKSEGISGIYKG----LTPTILKQGSNQAIRFFVLE 211
            .  ..::......|:.|       .:.||....|:.|:::|    |....|..|: |...|...:
  Fly   133 L--QSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGA-QIATFGKTK 194

  Fly   212 SLKDLYKGDDHTKPVPKLVVGVF--GAIAGAASVFGNTPLDVVKTRM--QGLEAS----KYKNTA 268
            :|  |.:.|..|:|    .:..|  |.|||:......||.||:.||:  ||::|.    .|:...
  Fly   195 AL--LVQYDLVTQP----TLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWL 253

  Fly   269 HCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNK 314
            .|.|:||::||....|||......|:.....:..:.:|..:.:..|
  Fly   254 DCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 75/292 (26%)
Mito_carr 34..117 CDD:278578 22/83 (27%)
Mito_carr 125..220 CDD:278578 22/110 (20%)
Mito_carr 235..314 CDD:278578 25/84 (30%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 22/79 (28%)
PTZ00169 5..293 CDD:240302 76/298 (26%)
Mito_carr 101..200 CDD:278578 22/103 (21%)
Mito_carr 206..301 CDD:278578 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.