DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG4995

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:319 Identity:99/319 - (31%)
Similarity:141/319 - (44%) Gaps:38/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PYRRRPWMTEHGAAAADSGQVGLKG------------IVAGGITGGIEICITYPTEYVKTQLQLD 64
            |||:|         .::.|.:.||.            .|||.:.|...:.:.:|.:.||..||.|
  Fly    16 PYRKR---------GSEIGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTD 71

  Fly    65 EKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSN 129
            :. ...||.|.|.|.:..|....|:|||||:|..:.|....:|..||.:..::..:.|.....|:
  Fly    72 DP-RNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRLSNDPNSLTSH 135

  Fly   130 SGKLLCGLGAGVCEAIVAVTPMETIKVKF-INDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLT 193
               ...|..|||.:..|. .|||..|.:. ::.|.....||.|..|.:..|:|:|||.|.:||||
  Fly   136 ---FFAGSIAGVAQGFVC-APMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLT 196

  Fly   194 PTILKQGSNQAIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQ- 257
            .|||:.....|..|...|.|....:    |..|...::.  |..||.:|.....|:|||||.|| 
  Fly   197 ATILRDIPGFASYFVSFEYLMRQVE----TPGVAYTLMA--GGCAGMSSWLACYPIDVVKTHMQA 255

  Fly   258 ---GLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFN 313
               |..| ||.....||::..:||||..|::|....|.|.....|..|.:....:|:.|
  Fly   256 DALGANA-KYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVLDICN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 91/284 (32%)
Mito_carr 34..117 CDD:278578 29/94 (31%)
Mito_carr 125..220 CDD:278578 32/95 (34%)
Mito_carr 235..314 CDD:278578 30/83 (36%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 27/89 (30%)
PTZ00169 41..295 CDD:240302 88/265 (33%)
Mito_carr 128..218 CDD:278578 33/93 (35%)
Mito_carr 221..304 CDD:278578 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.