DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG9582

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:286 Identity:77/286 - (26%)
Similarity:124/286 - (43%) Gaps:31/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VAGGITGGIEICITYPTEYVKTQLQLDEK---GAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLV 99
            :|||::|.|||...:|.:.|||::|:...   |....|....|.:.|.....|...|::|:...:
  Fly    18 LAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPI 82

  Fly   100 YGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRS 164
            ....||...:|..:|.||........|.:.....:.|..|.:.|:.: |.|.|.:|:    .|::
  Fly    83 CVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAAILESFL-VNPFEVVKI----TQQA 142

  Fly   165 GNPKFRGFAHGVGQIIKSE--GISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKG-DDHTKPV 226
            ...|.......|..|||.:  ||.|:|:|:|..:.:........|....:|||:... :|.|..:
  Fly   143 HRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNI 207

  Fly   227 PKLVVGVFGAIAGAASVFG---NTPLDVVKTRMQGLE----ASKYKNTAHCAVEILKNEGPAAFY 284
            .:.|:     |||.||...   :..||:.|.|:||.:    ..||:.|........|.||..:.:
  Fly   208 LRKVI-----IAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEEGFRSLF 267

  Fly   285 KGTVPRLGRVCLDV----AITFMIYD 306
            ||    ||.:.|.|    |:..:.|:
  Fly   268 KG----LGAMILRVGPGGAMLLVTYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 76/280 (27%)
Mito_carr 34..117 CDD:278578 23/81 (28%)
Mito_carr 125..220 CDD:278578 24/97 (25%)
Mito_carr 235..314 CDD:278578 25/83 (30%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 77/286 (27%)
Mito_carr 17..104 CDD:278578 25/85 (29%)
Mito_carr 109..196 CDD:278578 23/91 (25%)
Mito_carr 216..295 CDD:278578 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.