DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Rim2

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:189 Identity:48/189 - (25%)
Similarity:85/189 - (44%) Gaps:24/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNG-----IFDCVKKTVGERGFLGLYRGLS 96
            |::....|.:....|.|..:|||::|||       ||.     :..|:::...:.|....|:|::
  Fly   171 IMSAASAGFVSSTATNPIWFVKTRMQLD-------YNSKVQMTVRQCIERVYAQGGVAAFYKGIT 228

  Fly    97 VLVYGSIPKSAARFGAFEFLKSNAVDSRGQ----LSNSGKLLCGLGAGVCEAIVA---VTPMETI 154
            ...:| |.::...|..:||:||..::.|.|    ...|...|..:.||.....:|   ..|.|..
  Fly   229 ASYFG-ICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVA 292

  Fly   155 KVKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESL 213
            :.:.   :..|| |:..|...:..:.|.||.:|:|:||...:::|..|.||.....|::
  Fly   293 RTRL---REEGN-KYNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 48/189 (25%)
Mito_carr 34..117 CDD:278578 21/84 (25%)
Mito_carr 125..220 CDD:278578 24/96 (25%)
Mito_carr 235..314 CDD:278578
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578
Mito_carr 163..253 CDD:278578 23/89 (26%)
Mito_carr 268..355 CDD:278578 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.