DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Ant2

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:317 Identity:92/317 - (29%)
Similarity:135/317 - (42%) Gaps:38/317 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EHGAAAADSGQVG--LKGIVAGGITGGIEICITYPTEYVKTQLQLDEK----GAAKKYNGIFDCV 79
            |.|......|.:.  |...:.||::..|......|.|.||..||:.|.    .|.::|.||.||.
  Fly     4 EGGGGGHGKGDLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCF 68

  Fly    80 KKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKS---NAVDSRGQLSN--SGKLLCGLGA 139
            .:...|:||...:||....|....|..|..|...:..||   ..||...|...  :|.|..| ||
  Fly    69 IRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASG-GA 132

  Fly   140 GVCEAIVAVTPMETIKVKFIND-QRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQ 203
            ....::..|.|::..:.:...| .:.||.:|.|....:.::|||:|..|:|:|...::......:
  Fly   133 AGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYR 197

  Fly   204 AIRFFVLESLKDLYKGDDHTKPVPK--------LVVGVFGAIAGAASVFGNTPLDVVKTRM---Q 257
            |..|...::.:|..       |.||        .:..|...:||.||.    |.|.|:.||   .
  Fly   198 AAYFGFYDTCRDFL-------PNPKSTPFYVSWAIAQVVTTVAGIASY----PFDTVRRRMMMQS 251

  Fly   258 GLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLF 312
            ||:.|:  |||||||.:.|.|.||..||:||.:..:.| ....|:...:||.....|
  Fly   252 GLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 86/290 (30%)
Mito_carr 34..117 CDD:278578 26/86 (30%)
Mito_carr 125..220 CDD:278578 23/97 (24%)
Mito_carr 235..314 CDD:278578 32/83 (39%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 88/302 (29%)
Mito_carr 17..111 CDD:278578 28/93 (30%)
Mito_carr 119..215 CDD:278578 23/103 (22%)
Mito_carr 218..307 CDD:278578 32/93 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.