DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and sesB

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:317 Identity:91/317 - (28%)
Similarity:135/317 - (42%) Gaps:47/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MTEHGAAAADSGQVG-LKGIVAGGITGGIEICITYPTEYVKTQLQLD----EKGAAKKYNGIFDC 78
            :|.......|...|| :|...||||:..:......|.|.||..||:.    :....|:|.|:.||
  Fly     8 ITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDC 72

  Fly    79 VKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFE------FLKSNAVDSRGQLSN--SGKLLC 135
            ..:...|:||...:||....|....|..|..| ||:      ||  ..||...|...  :|.|..
  Fly    73 FIRIPKEQGFSSFWRGNLANVIRYFPTQALNF-AFKDKYKQVFL--GGVDKNTQFWRYFAGNLAS 134

  Fly   136 GLGAGVCEAIVAVTPMETIKVKFINDQ-RSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQ 199
            | ||....::..|.|::..:.:...|. :.|..:|.|..:.:.:|.||:||.|:|:|...::  |
  Fly   135 G-GAAGATSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSV--Q 196

  Fly   200 G--SNQAIRFFVLESLKDLYKGDDHTKPVPK--------LVVGVFGAIAGAASVFGNTPLDVVKT 254
            |  ..:|..|...::.:.:.       |.||        .:..|...:||..|.    |.|.|:.
  Fly   197 GIIIYRAAYFGFYDTARGML-------PDPKNTPIYISWAIAQVVTTVAGIVSY----PFDTVRR 250

  Fly   255 RM---QGLEASK--YKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306
            ||   .|.:|::  ||||.||...|.|.||..||:||....:.| ....|...::||
  Fly   251 RMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILR-GTGGAFVLVLYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 85/295 (29%)
Mito_carr 34..117 CDD:278578 28/92 (30%)
Mito_carr 125..220 CDD:278578 24/99 (24%)
Mito_carr 235..314 CDD:278578 28/77 (36%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 31/99 (31%)
PTZ00169 23..312 CDD:240302 87/302 (29%)
Mito_carr 124..220 CDD:278578 24/105 (23%)
Mito_carr 223..312 CDD:278578 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.