DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and CG5254

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:300 Identity:94/300 - (31%)
Similarity:142/300 - (47%) Gaps:44/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVAGGITGGIEICITYPTEYVKTQLQLDEKGAAK-------KYNGIFDCVKKTVGERGFLGLYRG 94
            ::|||..|.:|:||..|.:.|||::|:....|..       .|||:|||..|.....|....::|
  Fly    18 VLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKG 82

  Fly    95 LSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGK--------LLCGLGAGVCEAIVAVTPM 151
            :...:....||.|.:|..||..|        .|...|.        .|.||.||..||| ||.|.
  Fly    83 IMPPILAETPKRAIKFLVFEQTK--------PLFQFGSPTPTPLTFSLAGLTAGTLEAI-AVNPF 138

  Fly   152 ETIKVKFINDQRSGNPK--FRGFAHGVGQIIKSEGI--SGIYKGLTPTILKQGSNQAIRFFVLES 212
            |.:||.    |::...|  ...||...| ||:.:|:  ||:.||:|.|:.:.|....:.|....|
  Fly   139 EVVKVA----QQADRQKKMLSTFAVAKG-IIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHS 198

  Fly   213 LKDL---YKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLE----ASKYKNTAHC 270
            :|::   || :.|.:.:.|:.:|.   :||..:.|.|.|.||.|:|:||.:    ..||:.|...
  Fly   199 VKNVVPEYK-ESHLEFLRKVTIGF---LAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSS 259

  Fly   271 AVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMD 310
            ...:.:.||..|.|||.||::.|:....||..::::...|
  Fly   260 MGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFEYSYD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 93/290 (32%)
Mito_carr 34..117 CDD:278578 28/86 (33%)
Mito_carr 125..220 CDD:278578 36/109 (33%)
Mito_carr 235..314 CDD:278578 25/79 (32%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 30/101 (30%)
PTZ00169 19..301 CDD:240302 93/298 (31%)
Mito_carr 122..207 CDD:278578 32/90 (36%)
Mito_carr 209..305 CDD:278578 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.