DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and Y37B11A.3

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_498249.3 Gene:Y37B11A.3 / 189611 WormBaseID:WBGene00021345 Length:125 Species:Caenorhabditis elegans


Alignment Length:107 Identity:77/107 - (71%)
Similarity:87/107 - (81%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVL 98
            ::|||.||||||||||||:|||||||||||||:.|..|:.|..||||:||...||.|||||||||
 Worm    12 VRGIVIGGITGGIEICITFPTEYVKTQLQLDERSATPKFRGPIDCVKQTVNGHGFFGLYRGLSVL 76

  Fly    99 VYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAG 140
            :|||||||:.|||.||:|||.|.|.||.||...:||||||||
 Worm    77 LYGSIPKSSFRFGTFEYLKSQAADERGNLSPVMRLLCGLGAG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 77/107 (72%)
Mito_carr 34..117 CDD:278578 60/82 (73%)
Mito_carr 125..220 CDD:278578 11/16 (69%)
Mito_carr 235..314 CDD:278578
Y37B11A.3NP_498249.3 Mito_carr <29..95 CDD:278578 46/65 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159784
Domainoid 1 1.000 133 1.000 Domainoid score I3138
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.