DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sea and K11H3.3

DIOPT Version :9

Sequence 1:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_499187.1 Gene:K11H3.3 / 176398 WormBaseID:WBGene00010780 Length:312 Species:Caenorhabditis elegans


Alignment Length:283 Identity:196/283 - (69%)
Similarity:233/283 - (82%) Gaps:0/283 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVL 98
            ::|||.||||||||||||:|||||||||||||:.|..|:.|..||||:||...||.|||||||||
 Worm    26 VRGIVIGGITGGIEICITFPTEYVKTQLQLDERSATPKFRGPIDCVKQTVNGHGFFGLYRGLSVL 90

  Fly    99 VYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQR 163
            :|||||||:.|||.||:|||.|.|.||.||...:||||||||:.||:.|||||||:|||||:||.
 Worm    91 LYGSIPKSSFRFGTFEYLKSQAADERGNLSPVMRLLCGLGAGLSEAVFAVTPMETVKVKFIHDQG 155

  Fly   164 SGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHTKPVPK 228
            ...||::||.||||.|:|:||:.|||||:|.|:.||||||||||||:|:|||.|:|.|:|:|:.|
 Worm   156 LAQPKYKGFVHGVGCIVKAEGLGGIYKGVTATMAKQGSNQAIRFFVMETLKDWYRGGDNTQPISK 220

  Fly   229 LVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGR 293
            .:||:.||:||||||:||||:||||||||||||.|||||..||::|.|.||..||||||||||.|
 Worm   221 PIVGLMGAVAGAASVYGNTPIDVVKTRMQGLEAKKYKNTLDCAMQIWKKEGFFAFYKGTVPRLSR 285

  Fly   294 VCLDVAITFMIYDSFMDLFNKVW 316
            |||||.||||||||.::..:..|
 Worm   286 VCLDVGITFMIYDSIIEFLDVYW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 188/267 (70%)
Mito_carr 34..117 CDD:278578 60/82 (73%)
Mito_carr 125..220 CDD:278578 63/94 (67%)
Mito_carr 235..314 CDD:278578 59/78 (76%)
K11H3.3NP_499187.1 Mito_carr <43..109 CDD:278578 46/65 (71%)
Mito_carr 117..211 CDD:278578 63/93 (68%)
Mito_carr 225..304 CDD:278578 59/78 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159783
Domainoid 1 1.000 133 1.000 Domainoid score I3138
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4362
Inparanoid 1 1.050 408 1.000 Inparanoid score I1065
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58666
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 1 1.000 - - oto18796
orthoMCL 1 0.900 - - OOG6_104005
Panther 1 1.100 - - LDO PTHR45788
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1828
SonicParanoid 1 1.000 - - X3276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.