DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33627 and CG33928

DIOPT Version :10

Sequence 1:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:60 Identity:15/60 - (25%)
Similarity:26/60 - (43%) Gaps:10/60 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 MTIVIKAFGKQGSQL--KCPHTKGLYV------YPNINIAENLPAFLPETDFKIEMNFLS 158
            |.:.:.|..|..|.:  .||:|..:.|      :.|....:.:|  |||.|:....|:.:
  Fly   108 MVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVP--LPEGDYVFNSNWFT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33627NP_001027406.1 DUF1091 71..152 CDD:461928 14/52 (27%)
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 14/52 (27%)

Return to query results.
Submit another query.